Structure of PDB 5yax Chain B Binding Site BS01

Receptor Information
>5yax Chain B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGPGLVKPSQTLSLTCGISGDSVSSKSAAWNWIRQSPSRGLEWL
GRTYYRSKWHNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCA
RGQMGALDVWGQGTTVTVSSQSVLTQPPSASGTPGQRVTISCSGSSSNIG
SYYVYWYQQFPGTAPKLLIYGNNQRPSGVPDRFSGSKSGTSASLAITGLQ
AEDEADYYCQSYDSSLSGVIFGGGTKLTVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yax A potent human neutralizing antibody Fc-dependently reduces established HBV infections
Resolution2.5 Å
Binding residue
(original residue number in PDB)		A38 R55 Y57 R59 G107 Q108 G113 S1036 Y1037 Y1038 Y1107
Binding residue
(residue number reindexed from 1)		A35 R52 Y54 R56 G102 Q103 G105 S151 Y152 Y153 Y212
External links