Structure of PDB 5y5w Chain B Binding Site BS01

Receptor Information
>5y5w Chain B (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHGSSENLYFQGSRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSL
YLIKYDGFDCVYGLELNKDERVSALEVLAHLADTMIGKAVEHMFETEDGS
KDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPSLV
GKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y5w Spindlin-1 recognizes methylations of K20 and R23 of histone H4 tail
Resolution3.3 Å
Binding residue
(original residue number in PDB)		F141 E142 W151 Y170 Y177 D184
Binding residue
(residue number reindexed from 1)		F94 E95 W104 Y123 Y130 D137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:5y5w, PDBe:5y5w, PDBj:5y5w
PDBsum5y5w
PubMed30381828
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]