Structure of PDB 5xxp Chain B Binding Site BS01

Receptor Information
>5xxp Chain B (length=87) Species: 106590 (Cupriavidus necator) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLER
SHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xxp Crystal structure of the DNA-binding domain of the LysR-type transcriptional regulator CbnR in complex with a DNA fragment of the recognition-binding site in the promoter region
Resolution2.55 Å
Binding residue
(original residue number in PDB)		N17 M18 A19 P30 T33 R50 H52
Binding residue
(residue number reindexed from 1)		N17 M18 A19 P30 T33 R50 H52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5xxp, PDBe:5xxp, PDBj:5xxp
PDBsum5xxp
PubMed29323785
UniProtQ9WXC7

[Back to BioLiP]