Structure of PDB 5xxf Chain B Binding Site BS01

Receptor Information

>5xxf Chain B (length=229) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCH
EKMPIFMDIAFIEYCFNLSQILWEYSLISNALERLENIELERQNCMREDG
LVKYTNELLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFT
KFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSR
YIQCTKLQLEVFCDYDFKQREIVKMLTSN

Ligand information

>5xxf Chain F (length=17) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NSDNIFVKPGEDLEIPL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5xxf Structure of the fission yeast S. pombe telomeric Tpz1-Poz1-Rap1 complex.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	N129 T132 L133 E136 E181 M207 F212 R218 Q221 C222
Binding residue (residue number reindexed from 1)	N111 T114 L115 E118 E163 M189 F194 R200 Q203 C204

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0000723	telomere maintenance
GO:0016233	telomere capping
GO:0032200	telomere organization

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070187	shelterin complex
GO:0140445	chromosome, telomeric repeat region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xxf, PDBe:5xxf, PDBj:5xxf
PDBsum	5xxf
PubMed	29160296
UniProt	O13852\|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]