Structure of PDB 5xo2 Chain B Binding Site BS01

Receptor Information
>5xo2 Chain B (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHGQS
FYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELD
TRSSGRQQWQSIEGTKLSIT
Ligand information
>5xo2 Chain X (length=7) Species: 10306 (Human alphaherpesvirus 1 strain KOS) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPATPAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xo2 Structural and thermodynamic analyses reveal critical features of glycopeptide recognition by the human PILR alpha immune cell receptor.
Resolution2.201 Å
Binding residue
(original residue number in PDB)
Q118 Q120
Binding residue
(residue number reindexed from 1)
Q88 Q90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5xo2, PDBe:5xo2, PDBj:5xo2
PDBsum5xo2
PubMed29046357
UniProtQ9UKJ1|PILRA_HUMAN Paired immunoglobulin-like type 2 receptor alpha (Gene Name=PILRA)

[Back to BioLiP]