Structure of PDB 5xhz Chain B Binding Site BS01

Receptor Information
>5xhz Chain B (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFP
SNFIKELSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xhz Biochemical and Structural Studies of the Interaction between ARAP1 and CIN85.
Resolution1.319 Å
Binding residue
(original residue number in PDB)		D124 D125
Binding residue
(residue number reindexed from 1)		D16 D17
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5xhz, PDBe:5xhz, PDBj:5xhz
PDBsum5xhz
PubMed29589748
UniProtQ8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 (Gene Name=Sh3kbp1)

[Back to BioLiP]