Structure of PDB 5wwc Chain B Binding Site BS01

Receptor Information
>5wwc Chain B (length=59) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGKKPVKVKTPAGKEAELVPEKVWAMAPKGRKGVKIGLFKDPETGKYFR
HKLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wwc Roles of Leu28 side chain intercalation in the interaction between Cren7 and DNA
Resolution1.9 Å
Binding residue
(original residue number in PDB)		V8 K9 E19
Binding residue
(residue number reindexed from 1)		V7 K8 E18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wwc, PDBe:5wwc, PDBj:5wwc
PDBsum5wwc
PubMed28377493
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]