Structure of PDB 5ws2 Chain B Binding Site BS01

Receptor Information
>5ws2 Chain B (length=463) Species: 1094980 (Methanolobus psychrophilus R15) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHSSGLVPRGSHMASTEIGIIAVGGYNEMGRNMTAIRVNEDIIIIDMGI
RLDRVQIHEDVDTDRMHSLELIEMGAIPDDTIMNEVNGNVRAIVCTHGHL
DHIGAIPKLAHRYAAPIIATPYTTALIKHQIDSERKFGVKNNIVALKAGE
TLEITKDITIEFINTQHSIIDTVFVAIHTPSGAVVYACDFKFDRTPTLGE
VPDFDRLKELGKEGVIALITESTNAGRNGKTPSELIAHMMLKDVLLGTEE
SAVGMIVTTFAAHIARVNSIVQFAQEMGRIPVLLGRSMERYVGTAYQLGY
IDLPENVEIYGSRRDIDNALKKIMEAGKDKYLPVMTGHQGEPGAVLGRIA
NGETPFKVETGDRIIFSANVIPNPMTQANRYALETKLKMKGARIYDNVHV
SGHAYREDHWELLRMLKPEHVIPAHGTIQMHSEYIQMAEDAGYSLGDTLH
LLRNGEELYIEED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ws2 New molecular insights into an archaeal RNase J reveal a conserved processive exoribonucleolysis mechanism of the RNase J family
Resolution2.398 Å
Binding residue
(original residue number in PDB)
L37 H84 L85 F245 A246 R271 S272 T321 E326 G328 A329 N354 I356 P357 S386 G387 H388 M415
Binding residue
(residue number reindexed from 1)
L52 H99 L100 F260 A261 R286 S287 T336 E341 G343 A344 N369 I371 P372 S401 G402 H403 M430
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Dec 2 23:14:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5ws2', asym_id = 'B', bs = 'BS01', title = 'New molecular insights into an archaeal RNase J ...xoribonucleolysis mechanism of the RNase J family'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5ws2', asym_id='B', bs='BS01', title='New molecular insights into an archaeal RNase J ...xoribonucleolysis mechanism of the RNase J family')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0004534,0046872', uniprot = '', pdbid = '5ws2', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0004534,0046872', uniprot='', pdbid='5ws2', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>