Structure of PDB 5wrv Chain B Binding Site BS01

Receptor Information
>5wrv Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQN
GSFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQT
DKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQ
SNWE
Ligand information
>5wrv Chain A (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PLFFDLALNHVAFPPLEDKLAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wrv Human apo-SRP72 and SRP68/72 complex structures reveal the molecular basis of protein translocation
Resolution1.7 Å
Binding residue
(original residue number in PDB)		W15 S16 V18 D44 T46 H49 C50 V53 C54 F82 Y86 K110 E113 Q117 Y120 Y143 E146 T149 N150
Binding residue
(residue number reindexed from 1)		W7 S8 V10 D36 T38 H41 C42 V45 C46 F74 Y78 K102 E105 Q109 Y112 Y135 E138 T141 N142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane

View graph for
Biological Process
External links
PDB RCSB:5wrv, PDBe:5wrv, PDBj:5wrv
PDBsum5wrv
PubMed28369529
UniProtO76094|SRP72_HUMAN Signal recognition particle subunit SRP72 (Gene Name=SRP72)

[Back to BioLiP]