Structure of PDB 5w7y Chain B Binding Site BS01

Receptor Information
>5w7y Chain B (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQL
RIKPIHTNPCFYQSSEKSQLLPLKPNLWCYLNPGDSFSLLVDKYIFRILS
IPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w7y Characterization of the APLF FHA-XRCC1 phosphopeptide interaction and its structural and functional implications.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P29 G32
Binding residue
(residue number reindexed from 1)		P27 G30
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008408 3'-5' exonuclease activity
Biological Process
GO:0006302 double-strand break repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5w7y, PDBe:5w7y, PDBj:5w7y
PDBsum5w7y
PubMed29059378
UniProtQ8IW19|APLF_HUMAN Aprataxin and PNK-like factor (Gene Name=APLF)

[Back to BioLiP]