Structure of PDB 5w6u Chain B Binding Site BS01

Receptor Information

>5w6u Chain B (length=171) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAINGITN
KVNTVIEKMNIQFTAVGKEFNKLEKRMENLNKKVDDGFLDIWTYNAELLV
LLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCDNECME
SVRNGTYDYPKYSEESKLNRE

Ligand information

>5w6u Chain D (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RPLEYFEWLSA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5w6u Potent peptidic fusion inhibitors of influenza virus.
Resolution	2.878 Å
Binding residue (original residue number in PDB)	D19 G20 W21 Q38 Q42 N53
Binding residue (residue number reindexed from 1)	D19 G20 W21 Q38 Q42 N53

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046789	host cell surface receptor binding

	Biological Process
GO:0019064	fusion of virus membrane with host plasma membrane

	Cellular Component
GO:0019031	viral envelope

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5w6u, PDBe:5w6u, PDBj:5w6u
PDBsum	5w6u
PubMed	28971971
UniProt	P03452\|HEMA_I34A1 Hemagglutinin (Gene Name=HA)

[Back to BioLiP]