Structure of PDB 5w5u Chain B Binding Site BS01

Receptor Information

>5w5u Chain B (length=171) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAINGITN
KVNTVIEKMNIQFTAVGKEFNKLEKRMENLNKKVDDGFLDIWTYNAELLV
LLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCDNECME
SVRNGTYDYPKYSEESKLNRE

Ligand information

>5w5u Chain D (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FPLEYFEWLSA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5w5u Potent peptidic fusion inhibitors of influenza virus.
Resolution	2.461 Å
Binding residue (original residue number in PDB)	I18 D19 G20 W21 Q38 Q42 T49 N53 I56
Binding residue (residue number reindexed from 1)	I18 D19 G20 W21 Q38 Q42 T49 N53 I56

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046789	host cell surface receptor binding

	Biological Process
GO:0019064	fusion of virus membrane with host plasma membrane

	Cellular Component
GO:0019031	viral envelope

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5w5u, PDBe:5w5u, PDBj:5w5u
PDBsum	5w5u
PubMed	28971971
UniProt	P03452\|HEMA_I34A1 Hemagglutinin (Gene Name=HA)

[Back to BioLiP]