Structure of PDB 5w5c Chain B Binding Site BS01

Receptor Information
>5w5c Chain B (length=54) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYV
Ligand information
>5w5c Chain E (length=25) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KYAKMEAEREVMRQGIRDKYGIKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w5c The primed SNARE-complexin-synaptotagmin complex for neuronal exocytosis.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		D214 M215 D218 M229
Binding residue
(residue number reindexed from 1)		D24 M25 D28 M39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005484 SNAP receptor activity
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5w5c, PDBe:5w5c, PDBj:5w5c
PDBsum5w5c
PubMed28813412
UniProtP32851|STX1A_RAT Syntaxin-1A (Gene Name=Stx1a)

[Back to BioLiP]