Structure of PDB 5w2m Chain B Binding Site BS01

Receptor Information
>5w2m Chain B (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFR
NQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAE
FLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYC
WENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w2m Molecular Interactions of a DNA Modifying Enzyme APOBEC3F Catalytic Domain with a Single-Stranded DNA.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		Y333 K337 F351 K352 P353 K355 G356 L357 K358 Y359
Binding residue
(residue number reindexed from 1)		Y144 K148 F162 K163 P164 K166 G167 L168 K169 Y170
Binding affinityPDBbind-CN: Kd=6.36uM
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity

View graph for
Molecular Function
External links
PDB RCSB:5w2m, PDBe:5w2m, PDBj:5w2m
PDBsum5w2m
PubMed29191651
UniProtQ8IUX4|ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F (Gene Name=APOBEC3F)

[Back to BioLiP]