Structure of PDB 5vxn Chain B Binding Site BS01

Receptor Information

>5vxn Chain B (length=191) Species: 83333 (Escherichia coli K-12)

NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKESVSRLLEKRLSPKESEVLRLFAEGF
LVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSS

Ligand information

>5vxn Chain E (length=18)

tttaggaaaaatcttaga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5vxn Structural Basis for DNA Recognition by the Two-Component Response Regulator RcsB.
• Resolution: 3.375 Å
• Binding residue (original residue number in PDB): L167 V168 T169 S183 K186 K187
• Binding residue (residue number reindexed from 1): L151 V152 T153 S167 K170 K171

Gene Ontology

Molecular Function

• GO:0001216 DNA-binding transcription activator activity
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0000160 phosphorelay signal transduction system
• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0031346 positive regulation of cell projection organization
• GO:0043470 regulation of carbohydrate catabolic process
• GO:0044011 single-species biofilm formation on inanimate substrate
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription
• GO:0046677 response to antibiotic
• GO:1901913 regulation of capsule organization
• GO:1902021 regulation of bacterial-type flagellum-dependent cell motility
• GO:1990451 cellular stress response to acidic pH

Cellular Component

• GO:0005667 transcription regulator complex
• GO:0005829 cytosol

External links

• PDB: RCSB:5vxn, PDBe:5vxn, PDBj:5vxn
• PDBsum: 5vxn
• PubMed: 29487239
• UniProt: P0DMC7|RCSB_ECOLI Transcriptional regulatory protein RcsB (Gene Name=rcsB)