Structure of PDB 5vsu Chain B Binding Site BS01

Receptor Information
>5vsu Chain B (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSMLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTD
EKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK
Ligand information
>5vsu Chain I (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauuugaaacaauacagagaugaucagcgguuccccugcauaaggagaac
cguuuuacaaagagauuuguuuu
..<<<<...................<<<<<<<<.<<.......>>.>>>>
>>>>...>>>>............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vsu Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K20 F35 N37 R63 G64 S65
Binding residue
(residue number reindexed from 1)		K23 F38 N40 R66 G67 S68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000398 mRNA splicing, via spliceosome
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vsu, PDBe:5vsu, PDBj:5vsu
PDBsum5vsu
PubMed29717126
UniProtP38203|LSM2_YEAST U6 snRNA-associated Sm-like protein LSm2 (Gene Name=LSM2)

[Back to BioLiP]