Structure of PDB 5vfx Chain B Binding Site BS01

Receptor Information
>5vfx Chain B (length=100) Species: 1502 (Clostridium perfringens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDT
VDGKLYLWRELEWIECAEDRFNKRIKIDGENMYAVVIKYSSYSILKRLYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vfx Crystal structure of TcpK in complex with oriT DNA of the antibiotic resistance plasmid pCW3.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		R28 R75 N82 Y84
Binding residue
(residue number reindexed from 1)		R27 R74 N81 Y83
Binding affinityPDBbind-CN: Kd=360nM
Enzymatic activity
Enzyme Commision number ?
External links