Structure of PDB 5vb9 Chain B Binding Site BS01

Receptor Information
>5vb9 Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFPRTVMVNLNIHNSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGC
INADGNVDYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTP
I
Ligand information
>5vb9 Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CWVLEYDMFGALHCR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vb9 Utilization of peptide phage display to investigate hotspots on IL-17A and what it means for drug discovery.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		L53 Y62 P63 S64 V65 W67
Binding residue
(residue number reindexed from 1)		L27 Y36 P37 S38 V39 W41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
Biological Process
GO:0006954 inflammatory response
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vb9, PDBe:5vb9, PDBj:5vb9
PDBsum5vb9
PubMed29329326
UniProtQ16552|IL17_HUMAN Interleukin-17A (Gene Name=IL17A)

[Back to BioLiP]