Structure of PDB 5vap Chain B Binding Site BS01

Receptor Information
>5vap Chain B (length=112) Species: 1570291 (Ebola virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCE
THLRREGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMFITA
FLNIALQLPCES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vap Ebola virus VP30 and nucleoprotein interactions modulate viral RNA synthesis.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		E197 L199 D202 Q203 E209 R213 F222 Q229 W230 M237
Binding residue
(residue number reindexed from 1)		E56 L58 D61 Q62 E68 R72 F81 Q88 W89 M96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5vap, PDBe:5vap, PDBj:5vap
PDBsum5vap
PubMed28593988
UniProtQ77DJ5|VP30_EBOZ5 Transcriptional activator VP30 (Gene Name=VP30)

[Back to BioLiP]