Structure of PDB 5vao Chain B Binding Site BS01

Receptor Information
>5vao Chain B (length=129) Species: 1570291 (Ebola virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPKITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSL
LCETHLRREGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMF
ITAFLNIALQLPCESSAVVVSGLRTLVPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vao Ebola virus VP30 and nucleoprotein interactions modulate viral RNA synthesis.
Resolution2.56 Å
Binding residue
(original residue number in PDB)
E197 L199 Q203 R213 F222 Q229 W230 S234
Binding residue
(residue number reindexed from 1)
E59 L61 Q65 R75 F84 Q91 W92 S96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5vao, PDBe:5vao, PDBj:5vao
PDBsum5vao
PubMed28593988
UniProtQ77DJ5|VP30_EBOZ5 Transcriptional activator VP30 (Gene Name=VP30)

[Back to BioLiP]