Structure of PDB 5v6x Chain B Binding Site BS01

Receptor Information
>5v6x Chain B (length=84) Species: 192952 (Methanosarcina mazei Go1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNS
RSSRPARALRYHKYRKTCKRCRVSDEDLNKFLTK
Ligand information
>5v6x Chain C (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaaccugaucauguagaucgaauggacucuaaauccguucagccgggu
uagauucccgggguuuccgc
<<<<<<<.<<<<.....>>>><<<<<<<.......>>>>>>>..<<<<<.
......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v6x Crystal structures reveal an elusive functional domain of pyrrolysyl-tRNA synthetase.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		K4 T8 V31 R33 R52
Binding residue
(residue number reindexed from 1)		K3 T7 V30 R32 R51
Enzymatic activity
Enzyme Commision number 6.1.1.26: pyrrolysine--tRNA(Pyl) ligase.
Gene Ontology
Molecular Function
GO:0004812 aminoacyl-tRNA ligase activity

View graph for
Molecular Function
External links
PDB RCSB:5v6x, PDBe:5v6x, PDBj:5v6x
PDBsum5v6x
PubMed29035363
UniProtQ8PWY1|PYLS_METMA Pyrrolysine--tRNA ligase (Gene Name=pylS)

[Back to BioLiP]