Structure of PDB 5v0l Chain B Binding Site BS01

Receptor Information

>5v0l Chain B (length=166) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVAL
KSTQEGEFLLQALVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELI
HTEDRAEFQRQLHWALDQLPPENASFMERCFRCDNSSGFLAMNFQGRLKY
LHLPPQLALFAIATPL

Ligand information

>5v0l Chain C (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggattgcgtgagaactg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5v0l Structural hierarchy controlling dimerization and target DNA recognition in the AHR transcriptional complex.
Resolution	4.0 Å
Binding residue (original residue number in PDB)	R37 H38 R39
Binding residue (residue number reindexed from 1)	R1 H2 R3
Binding affinity	PDBbind-CN: Kd=4.86nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006805	xenobiotic metabolic process
GO:0009410	response to xenobiotic stimulus

	Cellular Component
GO:0005634	nucleus
GO:0005667	transcription regulator complex
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v0l, PDBe:5v0l, PDBj:5v0l
PDBsum	5v0l
PubMed	28396409
UniProt	P30561\|AHR_MOUSE Aryl hydrocarbon receptor (Gene Name=Ahr)

[Back to BioLiP]