Structure of PDB 5umf Chain B Binding Site BS01

Receptor Information

>5umf Chain B (length=223) Species: 521006 (Neisseria gonorrhoeae NCCP11945)

AYRIAPSILSADFARLGEEVANVIAAGADLIHFDVMDNHYVPNLTFGPMV
CAALKPYASVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDRSL
SLIRDMGCQAGLVLNPATPVYVLENVLDRLDMVLLMSVNPGFGGQSFIPH
TLEKIRQVRAMLDRYEGKSGRRIAIEVDGGIKTDNIAAVARAGADTFVAG
SAIFGKPDYKAVIAAMRAELEKA

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5umf Chain B Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5umf Crystal Structure of a Ribulose-phosphate 3-epimerase from Neisseria gonorrhoeae with bound phosphate
• Resolution: 1.4 Å
• Binding residue (original residue number in PDB): H34 D36 H67 D180
• Binding residue (residue number reindexed from 1): H32 D34 H65 D178
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): S9 H34 D36 M38 H67 M69 M138 D180
• Catalytic site (residue number reindexed from 1): S7 H32 D34 M36 H65 M67 M136 D178
• Enzyme Commision number: 5.1.3.1: ribulose-phosphate 3-epimerase.

Gene Ontology

Molecular Function

• GO:0004750 D-ribulose-phosphate 3-epimerase activity
• GO:0016853 isomerase activity
• GO:0016857 racemase and epimerase activity, acting on carbohydrates and derivatives
• GO:0046872 metal ion binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006098 pentose-phosphate shunt
• GO:0009052 pentose-phosphate shunt, non-oxidative branch
• GO:0019323 pentose catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:5umf, PDBe:5umf, PDBj:5umf
• PDBsum: 5umf
• UniProt: B4RLV9