Structure of PDB 5ujt Chain B Binding Site BS01

Receptor Information

>5ujt Chain B (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTP
LGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTIS
PSTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDW
TFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQ

Ligand information

>5ujt Chain C (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VEELYLVAGEEGCGG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ujt C-terminal modification of the insulin B:11-23 peptide creates superagonists in mouse and human type 1 diabetes.
Resolution	1.94 Å
Binding residue (original residue number in PDB)	F11 G13 L26 Y30 Y37 Y60 W61 E74 V78 H81 N82 L85
Binding residue (residue number reindexed from 1)	F9 G11 L24 Y28 Y35 Y58 W59 E72 V76 H79 N80 L83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ujt, PDBe:5ujt, PDBj:5ujt
PDBsum	5ujt
PubMed	29255035
UniProt	O19707

[Back to BioLiP]