Structure of PDB 5ugf Chain B Binding Site BS01

Receptor Information
>5ugf Chain B (length=287) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LMENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFD
YSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFP
VRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRG
PNDERFGDRYPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPS
FETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
ESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD
Ligand information
Ligand IDIM5
InChIInChI=1S/C12H17N5O3/c13-12-15-9-6(1-14-10(9)11(20)16-12)2-17-3-7(5-18)8(19)4-17/h1,7-8,14,18-19H,2-5H2,(H3,13,15,16,20)/t7-,8+/m1/s1
InChIKeyGSPTUGDLYPMLCQ-SFYZADRCSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6c1c(c2c([nH]1)C(=O)NC(=N2)N)CN3CC(C(C3)O)CO
CACTVS 3.370NC1=Nc2c(CN3C[CH](O)[CH](CO)C3)c[nH]c2C(=O)N1
CACTVS 3.370NC1=Nc2c(CN3C[C@H](O)[C@@H](CO)C3)c[nH]c2C(=O)N1
ACDLabs 12.01O=C2NC(=Nc1c(cnc12)CN3CC(C(O)C3)CO)N
OpenEye OEToolkits 1.7.6c1c(c2c([nH]1)C(=O)NC(=N2)N)CN3C[C@@H]([C@H](C3)O)CO
FormulaC12 H17 N5 O3
Name2-amino-7-{[(3R,4R)-3-hydroxy-4-(hydroxymethyl)pyrrolidin-1-yl]methyl}-3,5-dihydro-4H-pyrrolo[3,2-d]pyrimidin-4-one;
DADMe-ImmG
ChEMBLCHEMBL475750
DrugBank
ZINCZINC000004846228
PDB chain5ugf Chain B Residue 306 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ugf Catalytic-site design for inverse heavy-enzyme isotope effects in human purine nucleoside phosphorylase.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
Y88 A116 A117 G118 F200 E201 V217 M219 N243 H257 V260
Binding residue
(residue number reindexed from 1)
Y89 A117 A118 G119 F201 E202 V218 M220 N244 H258 V261
Annotation score1
Binding affinityBindingDB: Ki=7nM
Enzymatic activity
Catalytic site (original residue number in PDB) S33 H64 H86 Y88 E89 A116 M219 S220 N243 V245 H257
Catalytic site (residue number reindexed from 1) S34 H65 H87 Y89 E90 A117 M220 S221 N244 V246 H258
Enzyme Commision number 2.4.2.1: purine-nucleoside phosphorylase.
Gene Ontology
Molecular Function
GO:0001882 nucleoside binding
GO:0002060 purine nucleobase binding
GO:0003824 catalytic activity
GO:0004731 purine-nucleoside phosphorylase activity
GO:0005515 protein binding
GO:0016757 glycosyltransferase activity
GO:0016763 pentosyltransferase activity
GO:0042301 phosphate ion binding
GO:0042802 identical protein binding
GO:0047975 guanosine phosphorylase activity
Biological Process
GO:0000255 allantoin metabolic process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006148 inosine catabolic process
GO:0006149 deoxyinosine catabolic process
GO:0006157 deoxyadenosine catabolic process
GO:0006166 purine ribonucleoside salvage
GO:0006204 IMP catabolic process
GO:0006738 nicotinamide riboside catabolic process
GO:0006955 immune response
GO:0009116 nucleoside metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0009410 response to xenobiotic stimulus
GO:0032743 positive regulation of interleukin-2 production
GO:0034418 urate biosynthetic process
GO:0042102 positive regulation of T cell proliferation
GO:0043101 purine-containing compound salvage
GO:0046059 dAMP catabolic process
GO:0046638 positive regulation of alpha-beta T cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0034774 secretory granule lumen
GO:0070062 extracellular exosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5ugf, PDBe:5ugf, PDBj:5ugf
PDBsum5ugf
PubMed28584087
UniProtP00491|PNPH_HUMAN Purine nucleoside phosphorylase (Gene Name=PNP)

[Back to BioLiP]