Structure of PDB 5udz Chain B Binding Site BS01

Receptor Information
>5udz Chain B (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHME
GFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYN
CGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
Ligand information
>5udz Chain V (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggguagugauuuuacccuggaga
<<<<<<.......>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5udz LIN28 Zinc Knuckle Domain Is Required and Sufficient to Induce let-7 Oligouridylation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G136 R138 C139 Y140 H148 A149 Q157 K159 K160 C161 H162 F163 M170 V171 K177
Binding residue
(residue number reindexed from 1)		G95 R97 C98 Y99 H107 A108 Q116 K118 K119 C120 H121 F122 M129 V130 K136
Binding affinityPDBbind-CN: Kd=92nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5udz, PDBe:5udz, PDBj:5udz
PDBsum5udz
PubMed28297670
UniProtQ9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)

[Back to BioLiP]