Structure of PDB 5u6a Chain B Binding Site BS01

Receptor Information
>5u6a Chain B (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQSPGKGLEWVAR
IYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAIYYCSRWG
GDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u6a Crystal Structure Of I83E Meditope-Enabled Trastuzumab With Azido-PEG3-Meditope
Resolution1.736 Å
Binding residue
(original residue number in PDB)		G9 Q39 P41 A92 I93 Q112 G113 L115 E155 P156 P174 A175 P209
Binding residue
(residue number reindexed from 1)		G9 Q39 P41 A92 I93 Q112 G113 L115 E155 P156 P174 A175 P209
External links