Structure of PDB 5tqs Chain B Binding Site BS01

Receptor Information
>5tqs Chain B (length=100) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRA
EGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tqs Multimodal Recognition of Diverse Peptides by the C-Terminal SH2 Domain of Phospholipase C-gamma 1 Protein.
Resolution1.876 Å
Binding residue
(original residue number in PDB)
R675 R694 R696 H714 C715 R716 L746 Y747
Binding residue
(residue number reindexed from 1)
R17 R36 R38 H56 C57 R58 L88 Y89
Enzymatic activity
Enzyme Commision number 3.1.4.11: phosphoinositide phospholipase C.
External links
PDB RCSB:5tqs, PDBe:5tqs, PDBj:5tqs
PDBsum5tqs
PubMed28376302
UniProtP08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (Gene Name=PLCG1)

[Back to BioLiP]