Structure of PDB 5teg Chain B Binding Site BS01

Receptor Information
>5teg Chain B (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE
YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG
RLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI
EAHPWLKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5teg Turning a Substrate Peptide into a Potent Inhibitor for the Histone Methyltransferase SETD8.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		Y262 G269 C270 M272 Y273 Y274 T307 Y334 Y336 G337 D338 R339 S343
Binding residue
(residue number reindexed from 1)		Y68 G75 C76 M78 Y79 Y80 T113 Y140 Y142 G143 D144 R145 S149
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0042799 histone H4K20 methyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:5teg, PDBe:5teg, PDBj:5teg
PDBsum5teg
PubMed27994746
UniProtQ9NQR1|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)

[Back to BioLiP]