Structure of PDB 5tbd Chain B Binding Site BS01

Receptor Information
>5tbd Chain B (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLTLSVTIGQPASISCKSSQSLLHSNGKTYLNWLLQRPGQSPK
RLIYLVSKLDSGVPDRFTGSGSGTDFTLKISSVEAEDLGVYYCWQGTHFP
ITFGSGTKLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tbd Structure and Characterisation of a Key Epitope in the Conserved C-Terminal Domain of the Malaria Vaccine Candidate MSP2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		H31 Y37 N39 R51 Y54 L55 W94 G96
Binding residue
(residue number reindexed from 1)		H31 Y37 N39 R51 Y54 L55 W94 G96
External links