Structure of PDB 5t5c Chain B Binding Site BS01

Receptor Information
>5t5c Chain B (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRK
HCKFKPDPNIPPTFSAFNEDYVGSGWSRGAMAPAGNNKFSSKAMAETFYL
SNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKK
IVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQP
QLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLY
LSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t5c A domain in human EXOG converts apoptotic endonuclease to DNA-repair exonuclease.
Resolution1.851 Å
Binding residue
(original residue number in PDB)		R109 S137 R138 G145 K148 F168 N171 S172 N176
Binding residue
(residue number reindexed from 1)		R49 S77 R78 G85 K88 F108 N111 S112 N116
Binding affinityPDBbind-CN: Kd=4.13uM
Enzymatic activity
Catalytic site (original residue number in PDB) C112 A140 N162 N171 E179
Catalytic site (residue number reindexed from 1) C52 A80 N102 N111 E119
Enzyme Commision number 3.1.30.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5t5c, PDBe:5t5c, PDBj:5t5c
PDBsum5t5c
PubMed28466855
UniProtQ9Y2C4|EXOG_HUMAN Nuclease EXOG, mitochondrial (Gene Name=EXOG)

[Back to BioLiP]