Structure of PDB 5t1i Chain B Binding Site BS01

Receptor Information
>5t1i Chain B (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANM
KCPQIVIAFYEERLTWHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t1i Peptide recognition by heterochromatin protein 1 (HP1) chromoshadow domains revisited: Plasticity in the pseudosymmetric histone binding site of human HP1.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		A129 T130 D131 S132 F167 R171 L172 T173 W174 H175
Binding residue
(residue number reindexed from 1)		A21 T22 D23 S24 F59 R63 L64 T65 W66 H67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5t1i, PDBe:5t1i, PDBj:5t1i
PDBsum5t1i
PubMed28223359
UniProtQ13185|CBX3_HUMAN Chromobox protein homolog 3 (Gene Name=CBX3)

[Back to BioLiP]