Structure of PDB 5t0n Chain B Binding Site BS01

Receptor Information
>5t0n Chain B (length=363) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYI
AIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKL
LAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCG
ILPEPPSEQSSPRDVEALMERMQQLQEEEMESRFELEKSESLPDMLCFVE
DPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKF
QAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLL
ERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAA
LLYALRAITRYMT
Ligand information
Ligand IDLEU
InChIInChI=1S/C6H13NO2/c1-4(2)3-5(7)6(8)9/h4-5H,3,7H2,1-2H3,(H,8,9)/t5-/m0/s1
InChIKeyROHFNLRQFUQHCH-YFKPBYRVSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0CC(C)C[C@@H](C(=O)O)N
CACTVS 3.341CC(C)C[C@H](N)C(O)=O
OpenEye OEToolkits 1.5.0CC(C)CC(C(=O)O)N
ACDLabs 10.04O=C(O)C(N)CC(C)C
CACTVS 3.341CC(C)C[CH](N)C(O)=O
FormulaC6 H13 N O2
NameLEUCINE
ChEMBLCHEMBL291962
DrugBankDB00149
ZINCZINC000003645145
PDB chain5t0n Chain B Residue 501 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t0n The apo-structure of the leucine sensor Sestrin2 is still elusive.
Resolution3.004 Å
Binding residue
(original residue number in PDB)		T374 Y375 T377 T386 R390 E451
Binding residue
(residue number reindexed from 1)		T257 Y258 T260 T269 R273 E334
Annotation score1
Enzymatic activity
Enzyme Commision number 1.11.1.-
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005092 GDP-dissociation inhibitor activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor
GO:0032542 sulfiredoxin activity
GO:0042731 PH domain binding
GO:0044877 protein-containing complex binding
GO:0070728 L-leucine binding
GO:0140311 protein sequestering activity
Biological Process
GO:0001932 regulation of protein phosphorylation
GO:0006111 regulation of gluconeogenesis
GO:0006635 fatty acid beta-oxidation
GO:0007005 mitochondrion organization
GO:0009749 response to glucose
GO:0016239 positive regulation of macroautophagy
GO:0030308 negative regulation of cell growth
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0032042 mitochondrial DNA metabolic process
GO:0032868 response to insulin
GO:0034198 cellular response to amino acid starvation
GO:0034599 cellular response to oxidative stress
GO:0042149 cellular response to glucose starvation
GO:0042593 glucose homeostasis
GO:0046323 D-glucose import
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070328 triglyceride homeostasis
GO:0071230 cellular response to amino acid stimulus
GO:0071233 cellular response to L-leucine
GO:0072593 reactive oxygen species metabolic process
GO:0098869 cellular oxidant detoxification
GO:1900182 positive regulation of protein localization to nucleus
GO:1901031 regulation of response to reactive oxygen species
GO:1902010 negative regulation of translation in response to endoplasmic reticulum stress
GO:1903432 regulation of TORC1 signaling
GO:1904262 negative regulation of TORC1 signaling
GO:1904263 positive regulation of TORC1 signaling
GO:1904504 positive regulation of lipophagy
GO:1990253 cellular response to leucine starvation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0031588 nucleotide-activated protein kinase complex
GO:0031932 TORC2 complex
GO:1990316 Atg1/ULK1 kinase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t0n, PDBe:5t0n, PDBj:5t0n
PDBsum5t0n
PubMed27649739
UniProtP58004|SESN2_HUMAN Sestrin-2 (Gene Name=SESN2)

[Back to BioLiP]