Structure of PDB 5szx Chain B Binding Site BS01

Receptor Information

>5szx Chain B (length=62) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPS
LDVDSIIPRTPD

Ligand information

>5szx Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcttcatcgctcagtgct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5szx Methyl-dependent and spatial-specific DNA recognition by the orthologous transcription factors human AP-1 and Epstein-Barr virus Zta.
Resolution	2.251 Å
Binding residue (original residue number in PDB)	S186 S189
Binding residue (residue number reindexed from 1)	S12 S15
Binding affinity	PDBbind-CN: Kd=0.017uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5szx, PDBe:5szx, PDBj:5szx
PDBsum	5szx
PubMed	28158710
UniProt	P03206\|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]