Structure of PDB 5sxp Chain B Binding Site BS01

Receptor Information
>5sxp Chain B (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGW
FPSNYVREVKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5sxp Molecular basis of interactions between SH3 domain-containing proteins and the proline-rich region of the ubiquitin ligase Itch.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		F193 D201 E202 E217 G219 W221 E223 W232 Y237
Binding residue
(residue number reindexed from 1)		F11 D19 E20 E35 G37 W39 E41 W50 Y55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5sxp, PDBe:5sxp, PDBj:5sxp
PDBsum5sxp
PubMed28235806
UniProtQ14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 (Gene Name=ARHGEF7)

[Back to BioLiP]