Structure of PDB 5svi Chain B Binding Site BS01

Receptor Information
>5svi Chain B (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEE
PED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5svi Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
Resolution1.613 Å
Binding residue
(original residue number in PDB)		S0 D1 Q2 T3 W4 V5 Q6 W13 D18 P24 E25 E47
Binding residue
(residue number reindexed from 1)		S5 D6 Q7 T8 W9 V10 Q11 W18 D23 P29 E30 E52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5svi, PDBe:5svi, PDBj:5svi
PDBsum5svi
PubMed27653685
UniProtQ14149|MORC3_HUMAN MORC family CW-type zinc finger protein 3 (Gene Name=MORC3)

[Back to BioLiP]