Structure of PDB 5okc Chain B Binding Site BS01

Receptor Information
>5okc Chain B (length=377) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SINLHSAPEYDPSYKLIQLTPELLDIIQDPVQNHQLRFKSLDKDKSEVVL
CSHDKTWVLKQRKHSNTVLLMREFVPEQPITFDETLLFGLSKPYMDVVGF
AKTESEFETRETHGELNLNSVPIYNGELDFSDKIMKRSSTKVIGTLEELL
ENSPCSALEGISKWHKIGGSVKDGVLCILSQDFLFKALHVLLMSAMAESL
DLQHLNVEDTHHAVGKDIEDEFNPYTREIIETVLNKFAVQEQENNTWRLR
IPFIAQWYGIQALRKYVSGISMPIDEFLIKWKSLFPPFFPCDIDIDMLRG
YHFKPTDKTVQYIAKSTLPMDPKERFKVLFRLQSQWDLEDIKPLIEELNS
RGMKIDSFIMKYARRKRLGKKTVVTSR
Ligand information
>5okc Chain G (length=26) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKIWVKYNEGFSNAVRKNVTWNNLWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5okc Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K16 K44 D45 E48 V49 L60 K61 Q62 R63 K64 H65 S66 N67 F108 E109
Binding residue
(residue number reindexed from 1)		K15 K43 D44 E47 V48 L59 K60 Q61 R62 K63 H64 S65 N66 F107 E108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034088 maintenance of mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5okc, PDBe:5okc, PDBj:5okc
PDBsum5okc
PubMed29225079
UniProtP25559|DCC1_YEAST Sister chromatid cohesion protein DCC1 (Gene Name=DCC1)

[Back to BioLiP]