Structure of PDB 5o63 Chain B Binding Site BS01

Receptor Information
>5o63 Chain B (length=161) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNELIKYAKELVRSAGKTLKSAAMFAKVLTPNDDSGRHGVLVPTEAYSFF
PDMPISDPSQNATSNFPAFDSLSKTHKTLAYKYYERYPERRITRMHGLLN
ERNYDPRLTIFLFARHTDGSSGYYFDCANSGSGGRFEVLFALCFGEAISP
KAGLFVVRPID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o63 UbaLAI is a monomeric Type IIE restriction enzyme.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
H76 K77 T78
Binding residue
(residue number reindexed from 1)
H76 K77 T78
External links