Structure of PDB 5nwk Chain B Binding Site BS01

Receptor Information

>5nwk Chain B (length=245) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNL
LSVAYKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELS
KICDGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEA
AESTLTAYKAAQDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNL
AKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG

Ligand information

>5nwk Chain Q (length=5) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YFSSN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5nwk Fusicoccin Activates KAT1 Channels by Stabilizing Their Interaction with 14-3-3 Proteins.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	K56 R63 K129 Y137 N182 Y188 N233 W237
Binding residue (residue number reindexed from 1)	K56 R63 K129 Y137 N182 Y188 N233 W237

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0007165	signal transduction
GO:0008104	protein localization

	Cellular Component
GO:0005737	cytoplasm

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nwk, PDBe:5nwk, PDBj:5nwk
PDBsum	5nwk
PubMed	28970335
UniProt	P93343\|1433C_TOBAC 14-3-3-like protein C

[Back to BioLiP]