Structure of PDB 5nqv Chain B Binding Site BS01

Receptor Information
>5nqv Chain B (length=179) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWD
EVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDL
KVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLI
EANPLFRDKLQFPTLRNSRLRTLINQSLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nqv Structure of the Arabidopsis TOPLESS corepressor provides insight into the evolution of transcriptional repression.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R67 K71 F74 K78 L111 L130 Y133 M143 E146
Binding residue
(residue number reindexed from 1)		R66 K70 F73 K77 L110 L129 Y132 M142 E145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5nqv, PDBe:5nqv, PDBj:5nqv
PDBsum5nqv
PubMed28698367
UniProtQ94AI7|TPL_ARATH Protein TOPLESS (Gene Name=TPL)

[Back to BioLiP]