Structure of PDB 5nqk Chain B Binding Site BS01

Receptor Information
>5nqk Chain B (length=242) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIV
NDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSQGLAGAGE
LFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYP
DHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQ
NPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nqk human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
Resolution3.25 Å
Binding residue
(original residue number in PDB)		D30 Q95 G96 L97
Binding residue
(residue number reindexed from 1)		D28 Q93 G94 L95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0007166 cell surface receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex
GO:0042105 alpha-beta T cell receptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nqk, PDBe:5nqk, PDBj:5nqk
PDBsum5nqk
PubMed
UniProtA0A075B6N1|TVB19_HUMAN T cell receptor beta variable 19 (Gene Name=TRBV19)

[Back to BioLiP]