Structure of PDB 5npi Chain B Binding Site BS01

Receptor Information
>5npi Chain B (length=233) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGPELVKPGASLKISCKTSGYTFTDFTFHWVKLSHGPSLEWIGT
IKPSNGDTAYNQKFKGKATLSVDKSASTAHIEFRSLTSEDSAVYFCARFG
GSYPYAMDYWGQGTSVIVSSGTGASDIVLTQSPATLSVTPGDRVSLSCRA
SQGIYNYVHWFQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSI
NSVESEDFGMYFCQQTNKWPLTFGAGTKLELKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5npi Conformational Flexibility in the Immunoglobulin-Like Domain of the Hepatitis C Virus Glycoprotein E2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K52 D57 T58 F99 Y105 Y170 Y172 T231 N232 K233 W234
Binding residue
(residue number reindexed from 1)		K52 D57 T58 F99 Y105 Y155 Y157 T216 N217 K218 W219
External links