Structure of PDB 5njk Chain B Binding Site BS01

Receptor Information
>5njk Chain B (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGF
FGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDR
AFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5njk A Numb-Mdm2 fuzzy complex reveals an isoform-specific involvement of Numb in breast cancer.
Resolution3.13 Å
Binding residue
(original residue number in PDB)
R53 E112 V114 S115 F116 C117 R132 W139 S155 H156 F162
Binding residue
(residue number reindexed from 1)
R28 E87 V89 S90 F91 C92 R107 W114 S130 H131 F137
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5njk, PDBe:5njk, PDBj:5njk
PDBsum5njk
PubMed29269425
UniProtP49757|NUMB_HUMAN Protein numb homolog (Gene Name=NUMB)

[Back to BioLiP]