Structure of PDB 5ni9 Chain B Binding Site BS01

Receptor Information
>5ni9 Chain B (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTV
YPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRASSAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ni9 Memory T cells specific to citrullinated alpha-enolase are enriched in the rheumatic joint.
Resolution1.33 Å
Binding residue
(original residue number in PDB)		H13 Y30 D57 W61 L67 K71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		H12 Y29 D56 W60 L66 K70 Y77 H80 N81 V84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ni9, PDBe:5ni9, PDBj:5ni9
PDBsum5ni9
PubMed29853344
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]