Structure of PDB 5new Chain B Binding Site BS01

Receptor Information
>5new Chain B (length=64) Species: 585035 (Escherichia coli S88) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5new Intermolecular base stacking mediates RNA-RNA interaction in a crystal structure of the RNA chaperone Hfq.
Resolution2.511 Å
Binding residue
(original residue number in PDB)		Y25 G29 I30 K31 L32 Q33 N48 Q52 T61
Binding residue
(residue number reindexed from 1)		Y21 G25 I26 K27 L28 Q29 N44 Q48 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003677 DNA binding
GO:0003681 bent DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0140691 RNA folding chaperone
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0008033 tRNA processing
GO:0034337 RNA folding
GO:0040033 sRNA-mediated post-transcriptional gene silencing
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
GO:0045975 positive regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5new, PDBe:5new, PDBj:5new
PDBsum5new
PubMed28852099
UniProtP0A6X3|HFQ_ECOLI RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]