Structure of PDB 5nc2 Chain B Binding Site BS01

Receptor Information
>5nc2 Chain B (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRK
IQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFAS
AMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nc2 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.58 Å
Binding residue
(original residue number in PDB)
Y16 K22 W23 T30 N71 F77 Q79 R81 V86
Binding residue
(residue number reindexed from 1)
Y14 K20 W21 T28 N69 F75 Q77 R79 V84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5nc2, PDBe:5nc2, PDBj:5nc2
PDBsum5nc2
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]