Structure of PDB 5nbx Chain B Binding Site BS01

Receptor Information
>5nbx Chain B (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVV
GRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANV
FASAMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nbx Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.65 Å
Binding residue
(original residue number in PDB)
Y16 D18
Binding residue
(residue number reindexed from 1)
Y17 D19
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5nbx, PDBe:5nbx, PDBj:5nbx
PDBsum5nbx
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]