Structure of PDB 5n89 Chain B Binding Site BS01

Receptor Information

>5n89 Chain B (length=122) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVKP

Ligand information

>5n89 Chain C (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GNSFDDWLASKG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5n89 Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution	1.27 Å
Binding residue (original residue number in PDB)	L25 S45 A46 W79 R84 N85
Binding residue (residue number reindexed from 1)	L12 S32 A33 W66 R71 N72

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:5n89, PDBe:5n89, PDBj:5n89
PDBsum	5n89
PubMed	28935886
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]