Structure of PDB 5n7x Chain B Binding Site BS01

Receptor Information
>5n7x Chain B (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n7x Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.12 Å
Binding residue
(original residue number in PDB)
L25 S45 V47 W79 R84 S88 T90 W92 W108 L110
Binding residue
(residue number reindexed from 1)
L12 S32 V34 W66 R71 S75 T77 W79 W95 L97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n7x, PDBe:5n7x, PDBj:5n7x
PDBsum5n7x
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]