Structure of PDB 5n1w Chain B Binding Site BS01

Receptor Information
>5n1w Chain B (length=166) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERVITEFWDGKIIMVSPDDPKYALKKAEEVRELVDSELGFQQVSLRCPSQ
TRTYMFVSNEKKIVGCLIAEPIREAYRVLAEPPSLHWRCSTEPEPAICGI
SRIWVFALMRRKAIASRMVDAVRSSFMYGSVLTTEEIAFSDPTPDGKLFA
STYCKVPDFLVYNFVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n1w Structural Basis of Eco1-Mediated Cohesin Acetylation.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
D677 P678 N699 V701
Binding residue
(residue number reindexed from 1)
D141 P142 N163 V165
Enzymatic activity
Enzyme Commision number ?
External links